Page for sale (servers, domain, scripts) - Price: 0.99 BTC or 9 999 USD. Users: 150-200K/day (GA: goo.gl/tWSMTK ) Please submit [email protected]

Czas: 05:04

Odsłony: 18 064

111 0

Dodany: 2009-11-18 22:31:28

Autor: AXEFLYERFV

Kategoria: Muzyka

HARDROCKSCORPIONSUFOMSGMICHAELSCHENKERFLYINGMARSHALLAMP

UFO [ REPEAT / LIGHTS OUT ] LIVE CHICAGO


Facebook